Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,849
  2. Avatar for Go Science 2. Go Science 71 pts. 10,746
  3. Avatar for Contenders 3. Contenders 49 pts. 10,663
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,658
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,596
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,383
  7. Avatar for VeFold 7. VeFold 8 pts. 10,340
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,230
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,117
  10. Avatar for Australia 10. Australia 2 pts. 10,037
  1. Avatar for heather-1 31. heather-1 Lv 1 14 pts. 10,244
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 13 pts. 10,230
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 12 pts. 10,196
  4. Avatar for Larini 34. Larini Lv 1 11 pts. 10,154
  5. Avatar for Artoria2e5 35. Artoria2e5 Lv 1 10 pts. 10,152
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 10 pts. 10,127
  7. Avatar for RichGuilmain 37. RichGuilmain Lv 1 9 pts. 10,118
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 8 pts. 10,117
  9. Avatar for Steven Pletsch 39. Steven Pletsch Lv 1 7 pts. 10,075
  10. Avatar for AlkiP0Ps 40. AlkiP0Ps Lv 1 7 pts. 10,037

Comments