Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,849
  2. Avatar for Go Science 2. Go Science 71 pts. 10,746
  3. Avatar for Contenders 3. Contenders 49 pts. 10,663
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,658
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,596
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,383
  7. Avatar for VeFold 7. VeFold 8 pts. 10,340
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,230
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,117
  10. Avatar for Australia 10. Australia 2 pts. 10,037
  1. Avatar for ProfVince 41. ProfVince Lv 1 6 pts. 10,019
  2. Avatar for O Seki To 42. O Seki To Lv 1 6 pts. 9,999
  3. Avatar for Merf 43. Merf Lv 1 5 pts. 9,986
  4. Avatar for Idiotboy 44. Idiotboy Lv 1 5 pts. 9,976
  5. Avatar for zbp 45. zbp Lv 1 4 pts. 9,954
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 4 pts. 9,949
  7. Avatar for frostschutz 47. frostschutz Lv 1 4 pts. 9,931
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 3 pts. 9,908
  9. Avatar for carxo 49. carxo Lv 1 3 pts. 9,829
  10. Avatar for Mozdzierz 50. Mozdzierz Lv 1 3 pts. 9,784

Comments