Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for Steven Pletsch 21. Steven Pletsch Lv 1 27 pts. 24,005
  2. Avatar for alcor29 22. alcor29 Lv 1 25 pts. 24,005
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 23 pts. 24,003
  4. Avatar for AmphotericinB 24. AmphotericinB Lv 1 21 pts. 24,000
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 20 pts. 23,990
  6. Avatar for spvincent 26. spvincent Lv 1 18 pts. 23,973
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 17 pts. 23,971
  8. Avatar for jausmh 28. jausmh Lv 1 15 pts. 23,962
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 14 pts. 23,943
  10. Avatar for manu8170 30. manu8170 Lv 1 13 pts. 23,924

Comments