Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for Altercomp 51. Altercomp Lv 1 2 pts. 23,347
  2. Avatar for Merf 52. Merf Lv 1 2 pts. 23,334
  3. Avatar for georg137 53. georg137 Lv 1 2 pts. 23,205
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 23,167
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 23,149
  6. Avatar for Arne Heessels 56. Arne Heessels Lv 1 1 pt. 23,144
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 23,139
  8. Avatar for pruneau_44 58. pruneau_44 Lv 1 1 pt. 23,132
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 23,127
  10. Avatar for jdmclure 60. jdmclure Lv 1 1 pt. 23,097

Comments