Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for Artoria2e5 31. Artoria2e5 Lv 1 12 pts. 23,910
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 11 pts. 23,843
  3. Avatar for Joanna_H 33. Joanna_H Lv 1 10 pts. 23,839
  4. Avatar for Hillbillie 34. Hillbillie Lv 1 9 pts. 23,833
  5. Avatar for ProfVince 35. ProfVince Lv 1 8 pts. 23,809
  6. Avatar for roarshock 36. roarshock Lv 1 8 pts. 23,808
  7. Avatar for ucad 37. ucad Lv 1 7 pts. 23,748
  8. Avatar for vybi 38. vybi Lv 1 6 pts. 23,736
  9. Avatar for Opelgang 39. Opelgang Lv 1 6 pts. 23,734
  10. Avatar for Larini 40. Larini Lv 1 5 pts. 23,725

Comments