Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for B. A. Beder 61. B. A. Beder Lv 1 1 pt. 23,088
  2. Avatar for aeroplanezz 62. aeroplanezz Lv 1 1 pt. 23,040
  3. Avatar for GlassBricks 63. GlassBricks Lv 1 1 pt. 23,029
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 23,014
  5. Avatar for Marcos Jr. 65. Marcos Jr. Lv 1 1 pt. 22,997
  6. Avatar for chr2stiana 66. chr2stiana Lv 1 1 pt. 22,968
  7. Avatar for Benoll 67. Benoll Lv 1 1 pt. 22,954
  8. Avatar for Farsheed 68. Farsheed Lv 1 1 pt. 22,917
  9. Avatar for lancevillegas 69. lancevillegas Lv 1 1 pt. 22,901
  10. Avatar for lnmllmnl 70. lnmllmnl Lv 1 1 pt. 22,883

Comments