Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 7,747
  1. Avatar for roarshock 31. roarshock Lv 1 8 pts. 8,953
  2. Avatar for georg137 32. georg137 Lv 1 7 pts. 8,949
  3. Avatar for MirsadaH 33. MirsadaH Lv 1 6 pts. 8,944
  4. Avatar for Arne Heessels 34. Arne Heessels Lv 1 6 pts. 8,924
  5. Avatar for carsonfb 35. carsonfb Lv 1 5 pts. 8,910
  6. Avatar for g_b 36. g_b Lv 1 5 pts. 8,909
  7. Avatar for dizzywings 37. dizzywings Lv 1 4 pts. 8,906
  8. Avatar for Larini 38. Larini Lv 1 4 pts. 8,902
  9. Avatar for heather-1 39. heather-1 Lv 1 3 pts. 8,899
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 3 pts. 8,883

Comments