Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,249
  2. Avatar for Contenders 2. Contenders 70 pts. 9,215
  3. Avatar for Go Science 3. Go Science 47 pts. 9,212
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,158
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,139
  6. Avatar for VeFold 6. VeFold 11 pts. 9,103
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 9,095
  8. Avatar for Australia 8. Australia 4 pts. 9,011
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 8,983
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,944
  1. Avatar for roarshock 31. roarshock Lv 1 8 pts. 8,953
  2. Avatar for georg137 32. georg137 Lv 1 7 pts. 8,949
  3. Avatar for MirsadaH 33. MirsadaH Lv 1 6 pts. 8,944
  4. Avatar for Arne Heessels 34. Arne Heessels Lv 1 6 pts. 8,924
  5. Avatar for carsonfb 35. carsonfb Lv 1 5 pts. 8,910
  6. Avatar for g_b 36. g_b Lv 1 5 pts. 8,909
  7. Avatar for dizzywings 37. dizzywings Lv 1 4 pts. 8,906
  8. Avatar for Larini 38. Larini Lv 1 4 pts. 8,902
  9. Avatar for heather-1 39. heather-1 Lv 1 3 pts. 8,899
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 3 pts. 8,883

Comments