Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,249
  2. Avatar for Contenders 2. Contenders 70 pts. 9,215
  3. Avatar for Go Science 3. Go Science 47 pts. 9,212
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,158
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,139
  6. Avatar for VeFold 6. VeFold 11 pts. 9,103
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 9,095
  8. Avatar for Australia 8. Australia 4 pts. 9,011
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 8,983
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,944
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 21 pts. 9,095
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 19 pts. 9,089
  3. Avatar for SemperRabbit 23. SemperRabbit Lv 1 18 pts. 9,087
  4. Avatar for akaaka 24. akaaka Lv 1 16 pts. 9,085
  5. Avatar for silent gene 25. silent gene Lv 1 15 pts. 9,080
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 13 pts. 9,030
  7. Avatar for phi16 27. phi16 Lv 1 12 pts. 9,011
  8. Avatar for AlkiP0Ps 28. AlkiP0Ps Lv 1 11 pts. 9,011
  9. Avatar for alcor29 29. alcor29 Lv 1 10 pts. 8,990
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 9 pts. 8,983

Comments