Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,249
  2. Avatar for Contenders 2. Contenders 70 pts. 9,215
  3. Avatar for Go Science 3. Go Science 47 pts. 9,212
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,158
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,139
  6. Avatar for VeFold 6. VeFold 11 pts. 9,103
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 9,095
  8. Avatar for Australia 8. Australia 4 pts. 9,011
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 8,983
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,944
  1. Avatar for osc 61. osc Lv 1 1 pt. 8,518
  2. Avatar for koolcoder101 62. koolcoder101 Lv 1 1 pt. 8,448
  3. Avatar for Yechan Kwon 63. Yechan Kwon Lv 1 1 pt. 8,437
  4. Avatar for Trajan464 64. Trajan464 Lv 1 1 pt. 8,396
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 8,391
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 8,349
  7. Avatar for jdmclure 67. jdmclure Lv 1 1 pt. 8,326
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 8,163
  9. Avatar for threedylan 69. threedylan Lv 1 1 pt. 8,133
  10. Avatar for The Nephrons 70. The Nephrons Lv 1 1 pt. 7,983

Comments