Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,222
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,155
  3. Avatar for Australia 3. Australia 49 pts. 11,021
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 11,007
  5. Avatar for Contenders 5. Contenders 22 pts. 10,988
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,952
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,911
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,877
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,567
  10. Avatar for VeFold 10. VeFold 2 pts. 10,395
  1. Avatar for phi16 21. phi16 Lv 1 25 pts. 10,933
  2. Avatar for fpc 22. fpc Lv 1 23 pts. 10,911
  3. Avatar for Joanna_H 23. Joanna_H Lv 1 21 pts. 10,877
  4. Avatar for georg137 24. georg137 Lv 1 20 pts. 10,873
  5. Avatar for guineapig 25. guineapig Lv 1 18 pts. 10,842
  6. Avatar for Aubade01 26. Aubade01 Lv 1 17 pts. 10,822
  7. Avatar for heather-1 27. heather-1 Lv 1 15 pts. 10,773
  8. Avatar for roarshock 28. roarshock Lv 1 14 pts. 10,741
  9. Avatar for drumpeter18yrs9yrs 29. drumpeter18yrs9yrs Lv 1 13 pts. 10,731
  10. Avatar for silent gene 30. silent gene Lv 1 12 pts. 10,711

Comments