Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,222
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,155
  3. Avatar for Australia 3. Australia 49 pts. 11,021
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 11,007
  5. Avatar for Contenders 5. Contenders 22 pts. 10,988
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,952
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,911
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,877
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,567
  10. Avatar for VeFold 10. VeFold 2 pts. 10,395
  1. Avatar for Hillbillie 41. Hillbillie Lv 1 4 pts. 10,395
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 4 pts. 10,364
  3. Avatar for Gonegirl 43. Gonegirl Lv 1 3 pts. 10,295
  4. Avatar for JackONeill12 44. JackONeill12 Lv 1 3 pts. 10,292
  5. Avatar for manu8170 45. manu8170 Lv 1 3 pts. 10,267
  6. Avatar for Vinara 46. Vinara Lv 1 2 pts. 10,266
  7. Avatar for Arne Heessels 47. Arne Heessels Lv 1 2 pts. 10,224
  8. Avatar for Commaster 48. Commaster Lv 1 2 pts. 10,155
  9. Avatar for carsonfb 49. carsonfb Lv 1 2 pts. 10,105
  10. Avatar for zbp 50. zbp Lv 1 2 pts. 10,074

Comments