Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Go Science 100 pts. 11,222
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,155
  3. Avatar for Australia 3. Australia 49 pts. 11,021
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 11,007
  5. Avatar for Contenders 5. Contenders 22 pts. 10,988
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,952
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,911
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,877
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,567
  10. Avatar for VeFold 10. VeFold 2 pts. 10,395

  1. Avatar for haleyg 61. haleyg Lv 1 1 pt. 9,875
  2. Avatar for mibrammall 62. mibrammall Lv 1 1 pt. 9,829
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 1 pt. 9,815
  4. Avatar for mengzach 64. mengzach Lv 1 1 pt. 9,749
  5. Avatar for DScott 65. DScott Lv 1 1 pt. 9,682
  6. Avatar for Dr.Sillem 66. Dr.Sillem Lv 1 1 pt. 9,668
  7. Avatar for dy9110 67. dy9110 Lv 1 1 pt. 9,662
  8. Avatar for rinze 68. rinze Lv 1 1 pt. 9,630
  9. Avatar for jdmclure 69. jdmclure Lv 1 1 pt. 9,620
  10. Avatar for Mohoernchen 70. Mohoernchen Lv 1 1 pt. 9,604

Comments