Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612

  1. Avatar for grogar7 21. grogar7 Lv 1 32 pts. 9,722
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 30 pts. 9,712
  3. Avatar for silent gene 23. silent gene Lv 1 29 pts. 9,709
  4. Avatar for akaaka 24. akaaka Lv 1 27 pts. 9,708
  5. Avatar for georg137 25. georg137 Lv 1 25 pts. 9,705
  6. Avatar for jausmh 26. jausmh Lv 1 23 pts. 9,692
  7. Avatar for roarshock 27. roarshock Lv 1 22 pts. 9,692
  8. Avatar for AlkiP0Ps 28. AlkiP0Ps Lv 1 20 pts. 9,686
  9. Avatar for phi16 29. phi16 Lv 1 19 pts. 9,673
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 18 pts. 9,656

Comments