Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 18,730
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 18,572
  3. Avatar for Go Science 3. Go Science 54 pts. 18,473
  4. Avatar for Australia 4. Australia 38 pts. 18,336
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 27 pts. 18,130
  6. Avatar for Contenders 6. Contenders 18 pts. 18,122
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 17,931
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 17,739
  9. Avatar for Russian team 9. Russian team 5 pts. 17,515
  10. Avatar for VeFold 10. VeFold 3 pts. 17,340
  1. Avatar for Madis731 51. Madis731 Lv 1 1 pt. 9,452
  2. Avatar for hada 52. hada Lv 1 1 pt. 9,281
  3. Avatar for VU21BTEN0100050 53. VU21BTEN0100050 Lv 1 1 pt. 9,237
  4. Avatar for AlphaFold2 54. AlphaFold2 Lv 1 1 pt. 9,110
  5. Avatar for Kyle123 55. Kyle123 Lv 1 1 pt. 8,869
  6. Avatar for Oransche 56. Oransche Lv 1 1 pt. 8,697
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 8,458
  8. Avatar for vinsi 58. vinsi Lv 1 1 pt. 8,364
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 7,826
  10. Avatar for Tian00 60. Tian00 Lv 1 1 pt. 7,232

Comments