Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 18,730
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 18,572
  3. Avatar for Go Science 3. Go Science 54 pts. 18,473
  4. Avatar for Australia 4. Australia 38 pts. 18,336
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 27 pts. 18,130
  6. Avatar for Contenders 6. Contenders 18 pts. 18,122
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 17,931
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 17,739
  9. Avatar for Russian team 9. Russian team 5 pts. 17,515
  10. Avatar for VeFold 10. VeFold 3 pts. 17,340
  1. Avatar for kitsoune 41. kitsoune Lv 1 4 pts. 12,717
  2. Avatar for Hillbillie 42. Hillbillie Lv 1 3 pts. 12,712
  3. Avatar for Larini 43. Larini Lv 1 3 pts. 12,549
  4. Avatar for phi16 44. phi16 Lv 1 3 pts. 12,287
  5. Avatar for pizpot 45. pizpot Lv 1 2 pts. 12,137
  6. Avatar for zbp 46. zbp Lv 1 2 pts. 12,080
  7. Avatar for Lereveur 47. Lereveur Lv 1 2 pts. 10,466
  8. Avatar for iikorni 48. iikorni Lv 1 2 pts. 9,810
  9. Avatar for rinze 49. rinze Lv 1 2 pts. 9,732
  10. Avatar for Antibrad 50. Antibrad Lv 1 1 pt. 9,490

Comments