Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 18,730
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 18,572
  3. Avatar for Go Science 3. Go Science 54 pts. 18,473
  4. Avatar for Australia 4. Australia 38 pts. 18,336
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 27 pts. 18,130
  6. Avatar for Contenders 6. Contenders 18 pts. 18,122
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 17,931
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 17,739
  9. Avatar for Russian team 9. Russian team 5 pts. 17,515
  10. Avatar for VeFold 10. VeFold 3 pts. 17,340

  1. Avatar for Arne Heessels 31. Arne Heessels Lv 1 10 pts. 16,467
  2. Avatar for Serca 32. Serca Lv 1 9 pts. 16,458
  3. Avatar for jamiexq 33. jamiexq Lv 1 9 pts. 15,476
  4. Avatar for BackBuffer 34. BackBuffer Lv 1 8 pts. 13,666
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 7 pts. 13,532
  6. Avatar for blazegeek 36. blazegeek Lv 1 6 pts. 13,205
  7. Avatar for ProfVince 37. ProfVince Lv 1 6 pts. 13,080
  8. Avatar for maithra 38. maithra Lv 1 5 pts. 12,993
  9. Avatar for roarshock 39. roarshock Lv 1 5 pts. 12,977
  10. Avatar for Trajan464 40. Trajan464 Lv 1 4 pts. 12,809

Comments