Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 22,197
  2. Avatar for Go Science 2. Go Science 63 pts. 22,187
  3. Avatar for Contenders 3. Contenders 37 pts. 22,133
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 22,131
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 22,058
  6. Avatar for Australia 6. Australia 5 pts. 22,045
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 22,045
  8. Avatar for Kotocycle 8. Kotocycle 1 pt. 22,004
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,579
  10. Avatar for VeFold 10. VeFold 1 pt. 21,343
  1. Avatar for grogar7 11. grogar7 Lv 1 47 pts. 22,130
  2. Avatar for blazegeek 12. blazegeek Lv 1 43 pts. 22,123
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 40 pts. 22,120
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 36 pts. 22,116
  5. Avatar for gmn 15. gmn Lv 1 33 pts. 22,093
  6. Avatar for fpc 16. fpc Lv 1 30 pts. 22,058
  7. Avatar for guineapig 17. guineapig Lv 1 28 pts. 22,048
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 25 pts. 22,045
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 23 pts. 22,045
  10. Avatar for Phyx 20. Phyx Lv 1 21 pts. 22,040

Comments