Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 22,197
  2. Avatar for Go Science 2. Go Science 63 pts. 22,187
  3. Avatar for Contenders 3. Contenders 37 pts. 22,133
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 22,131
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 22,058
  6. Avatar for Australia 6. Australia 5 pts. 22,045
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 22,045
  8. Avatar for Kotocycle 8. Kotocycle 1 pt. 22,004
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,579
  10. Avatar for VeFold 10. VeFold 1 pt. 21,343
  1. Avatar for spvincent 21. spvincent Lv 1 19 pts. 22,035
  2. Avatar for NPrincipi 22. NPrincipi Lv 1 17 pts. 22,017
  3. Avatar for drjr 23. drjr Lv 1 16 pts. 22,004
  4. Avatar for Ikuso 24. Ikuso Lv 1 14 pts. 22,004
  5. Avatar for Aubade01 25. Aubade01 Lv 1 13 pts. 21,963
  6. Avatar for akaaka 26. akaaka Lv 1 11 pts. 21,945
  7. Avatar for georg137 27. georg137 Lv 1 10 pts. 21,937
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 9 pts. 21,909
  9. Avatar for Steven Pletsch 29. Steven Pletsch Lv 1 8 pts. 21,901
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 7 pts. 21,867

Comments