Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361

  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 53 pts. 9,669
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 50 pts. 9,668
  3. Avatar for jausmh 13. jausmh Lv 1 46 pts. 9,667
  4. Avatar for gmn 14. gmn Lv 1 43 pts. 9,665
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 40 pts. 9,653
  6. Avatar for phi16 16. phi16 Lv 1 37 pts. 9,652
  7. Avatar for guineapig 17. guineapig Lv 1 35 pts. 9,647
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 32 pts. 9,647
  9. Avatar for akaaka 19. akaaka Lv 1 30 pts. 9,630
  10. Avatar for roarshock 20. roarshock Lv 1 28 pts. 9,623

Comments