Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 53 pts. 9,669
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 50 pts. 9,668
  3. Avatar for jausmh 13. jausmh Lv 1 46 pts. 9,667
  4. Avatar for gmn 14. gmn Lv 1 43 pts. 9,665
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 40 pts. 9,653
  6. Avatar for phi16 16. phi16 Lv 1 37 pts. 9,652
  7. Avatar for guineapig 17. guineapig Lv 1 35 pts. 9,647
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 32 pts. 9,647
  9. Avatar for akaaka 19. akaaka Lv 1 30 pts. 9,630
  10. Avatar for roarshock 20. roarshock Lv 1 28 pts. 9,623

Comments