Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361
  1. Avatar for maithra 31. maithra Lv 1 11 pts. 9,506
  2. Avatar for heather-1 32. heather-1 Lv 1 10 pts. 9,498
  3. Avatar for RichGuilmain 33. RichGuilmain Lv 1 9 pts. 9,481
  4. Avatar for ComputerMage 34. ComputerMage Lv 1 8 pts. 9,475
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 8 pts. 9,471
  6. Avatar for Larini 36. Larini Lv 1 7 pts. 9,469
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 6 pts. 9,419
  8. Avatar for davidoskky 38. davidoskky Lv 1 6 pts. 9,398
  9. Avatar for Arne Heessels 39. Arne Heessels Lv 1 5 pts. 9,365
  10. Avatar for jamiexq 40. jamiexq Lv 1 5 pts. 9,359

Comments