Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398

  1. Avatar for maithra 31. maithra Lv 1 11 pts. 9,506
  2. Avatar for heather-1 32. heather-1 Lv 1 10 pts. 9,498
  3. Avatar for RichGuilmain 33. RichGuilmain Lv 1 9 pts. 9,481
  4. Avatar for ComputerMage 34. ComputerMage Lv 1 8 pts. 9,475
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 8 pts. 9,471
  6. Avatar for Larini 36. Larini Lv 1 7 pts. 9,469
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 6 pts. 9,419
  8. Avatar for davidoskky 38. davidoskky Lv 1 6 pts. 9,398
  9. Avatar for Arne Heessels 39. Arne Heessels Lv 1 5 pts. 9,365
  10. Avatar for jamiexq 40. jamiexq Lv 1 5 pts. 9,359

Comments