Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361

  1. Avatar for pfirth 41. pfirth Lv 1 4 pts. 9,357
  2. Avatar for fpc 42. fpc Lv 1 4 pts. 9,339
  3. Avatar for Hillbillie 43. Hillbillie Lv 1 3 pts. 9,336
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 3 pts. 9,334
  5. Avatar for Joanna_H 45. Joanna_H Lv 1 3 pts. 9,332
  6. Avatar for ProfVince 46. ProfVince Lv 1 3 pts. 9,311
  7. Avatar for DScott 47. DScott Lv 1 2 pts. 9,301
  8. Avatar for zbp 48. zbp Lv 1 2 pts. 9,299
  9. Avatar for JackONeill12 49. JackONeill12 Lv 1 2 pts. 9,279
  10. Avatar for kitsoune 50. kitsoune Lv 1 2 pts. 9,275

Comments