Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398
  1. Avatar for pfirth 41. pfirth Lv 1 4 pts. 9,357
  2. Avatar for fpc 42. fpc Lv 1 4 pts. 9,339
  3. Avatar for Hillbillie 43. Hillbillie Lv 1 3 pts. 9,336
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 3 pts. 9,334
  5. Avatar for Joanna_H 45. Joanna_H Lv 1 3 pts. 9,332
  6. Avatar for ProfVince 46. ProfVince Lv 1 3 pts. 9,311
  7. Avatar for DScott 47. DScott Lv 1 2 pts. 9,301
  8. Avatar for zbp 48. zbp Lv 1 2 pts. 9,299
  9. Avatar for JackONeill12 49. JackONeill12 Lv 1 2 pts. 9,279
  10. Avatar for kitsoune 50. kitsoune Lv 1 2 pts. 9,275

Comments