Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,828
  2. Avatar for Go Science 2. Go Science 70 pts. 9,760
  3. Avatar for Contenders 3. Contenders 47 pts. 9,716
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,684
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,647
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,613
  7. Avatar for Australia 7. Australia 7 pts. 9,602
  8. Avatar for Russian team 8. Russian team 4 pts. 9,527
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 9,419
  10. Avatar for VeFold 10. VeFold 1 pt. 9,398
  1. Avatar for yvonnnnne 71. yvonnnnne Lv 1 1 pt. 8,921
  2. Avatar for Vander 72. Vander Lv 1 1 pt. 8,892
  3. Avatar for shruty 73. shruty Lv 1 1 pt. 8,858
  4. Avatar for albinjl 74. albinjl Lv 1 1 pt. 8,849
  5. Avatar for Satyam.kr 75. Satyam.kr Lv 1 1 pt. 8,635
  6. Avatar for 0mkar 76. 0mkar Lv 1 1 pt. 8,609
  7. Avatar for dmacseng 77. dmacseng Lv 1 1 pt. 8,605
  8. Avatar for furi0us 78. furi0us Lv 1 1 pt. 8,558
  9. Avatar for Divya1808 79. Divya1808 Lv 1 1 pt. 8,541
  10. Avatar for jflat06 80. jflat06 Lv 1 1 pt. 8,361

Comments