Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092
  1. Avatar for roarshock 31. roarshock Lv 1 13 pts. 11,534
  2. Avatar for maithra 32. maithra Lv 1 12 pts. 11,444
  3. Avatar for Phyx 33. Phyx Lv 1 11 pts. 11,440
  4. Avatar for NPrincipi 34. NPrincipi Lv 1 10 pts. 11,411
  5. Avatar for alcor29 35. alcor29 Lv 1 9 pts. 11,386
  6. Avatar for silent gene 36. silent gene Lv 1 8 pts. 11,365
  7. Avatar for latin krepin 37. latin krepin Lv 1 7 pts. 11,206
  8. Avatar for pfirth 38. pfirth Lv 1 7 pts. 11,195
  9. Avatar for akaaka 39. akaaka Lv 1 6 pts. 11,109
  10. Avatar for ComputerMage 40. ComputerMage Lv 1 6 pts. 11,092

Comments