Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092
  1. Avatar for mengzach 51. mengzach Lv 1 2 pts. 10,693
  2. Avatar for Dr.Sillem 52. Dr.Sillem Lv 1 2 pts. 10,667
  3. Avatar for AHart313 53. AHart313 Lv 1 2 pts. 10,655
  4. Avatar for Arlind1 54. Arlind1 Lv 1 1 pt. 10,606
  5. Avatar for ivalnic 55. ivalnic Lv 1 1 pt. 10,605
  6. Avatar for BarrySampson 56. BarrySampson Lv 1 1 pt. 10,588
  7. Avatar for hada 57. hada Lv 1 1 pt. 10,585
  8. Avatar for SemperRabbit 58. SemperRabbit Lv 1 1 pt. 10,544
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 10,502
  10. Avatar for wosser1 60. wosser1 Lv 1 1 pt. 10,502

Comments