Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092

  1. Avatar for DScott 61. DScott Lv 1 1 pt. 10,461
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 1 pt. 10,400
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 10,388
  4. Avatar for dymineoum 64. dymineoum Lv 1 1 pt. 10,365
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 10,350
  6. Avatar for Merf 66. Merf Lv 1 1 pt. 10,332
  7. Avatar for rob_carrillo 67. rob_carrillo Lv 1 1 pt. 10,315
  8. Avatar for futsall 68. futsall Lv 1 1 pt. 10,242
  9. Avatar for Swapper242 69. Swapper242 Lv 1 1 pt. 10,156
  10. Avatar for almavher 70. almavher Lv 1 1 pt. 10,142

Comments