Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 11,646
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,487
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 11,396
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,804
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 10,618
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,949
  1. Avatar for Serca 11. Serca Lv 1 50 pts. 12,100
  2. Avatar for MicElephant 12. MicElephant Lv 1 47 pts. 12,073
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 43 pts. 12,068
  4. Avatar for g_b 14. g_b Lv 1 40 pts. 12,035
  5. Avatar for roarshock 15. roarshock Lv 1 37 pts. 12,030
  6. Avatar for fpc 16. fpc Lv 1 34 pts. 12,014
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 32 pts. 11,998
  8. Avatar for Galaxie 18. Galaxie Lv 1 29 pts. 11,974
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 27 pts. 11,961
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 25 pts. 11,939

Comments