Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662
  1. Avatar for Serca 11. Serca Lv 1 50 pts. 12,100
  2. Avatar for MicElephant 12. MicElephant Lv 1 47 pts. 12,073
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 43 pts. 12,068
  4. Avatar for g_b 14. g_b Lv 1 40 pts. 12,035
  5. Avatar for roarshock 15. roarshock Lv 1 37 pts. 12,030
  6. Avatar for fpc 16. fpc Lv 1 34 pts. 12,014
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 32 pts. 11,998
  8. Avatar for Galaxie 18. Galaxie Lv 1 29 pts. 11,974
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 27 pts. 11,961
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 25 pts. 11,939

Comments