Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 11,646
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,487
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 11,396
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,804
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 10,618
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,949
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 11,352
  2. Avatar for Marvelz 52. Marvelz Lv 1 1 pt. 11,331
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 11,240
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 1 pt. 11,189
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 11,165
  6. Avatar for Arne Heessels 56. Arne Heessels Lv 1 1 pt. 11,156
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 11,066
  8. Avatar for krzycho7 58. krzycho7 Lv 1 1 pt. 11,045
  9. Avatar for jamiexq 59. jamiexq Lv 1 1 pt. 11,032
  10. Avatar for Merf 60. Merf Lv 1 1 pt. 11,025

Comments