Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 11,352
  2. Avatar for Marvelz 52. Marvelz Lv 1 1 pt. 11,331
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 11,240
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 1 pt. 11,189
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 11,165
  6. Avatar for Arne Heessels 56. Arne Heessels Lv 1 1 pt. 11,156
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 11,066
  8. Avatar for krzycho7 58. krzycho7 Lv 1 1 pt. 11,045
  9. Avatar for jamiexq 59. jamiexq Lv 1 1 pt. 11,032
  10. Avatar for Merf 60. Merf Lv 1 1 pt. 11,025

Comments