Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662
  1. Avatar for KJ-scinerd 41. KJ-scinerd Lv 1 3 pts. 11,584
  2. Avatar for kitsoune 42. kitsoune Lv 1 3 pts. 11,582
  3. Avatar for TgamesPi 43. TgamesPi Lv 1 2 pts. 11,559
  4. Avatar for zbp 44. zbp Lv 1 2 pts. 11,504
  5. Avatar for ShadowTactics 45. ShadowTactics Lv 1 2 pts. 11,487
  6. Avatar for Trajan464 46. Trajan464 Lv 1 2 pts. 11,443
  7. Avatar for ProfVince 47. ProfVince Lv 1 2 pts. 11,413
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 11,398
  9. Avatar for Ikuso 49. Ikuso Lv 1 1 pt. 11,396
  10. Avatar for VU21BTEN0100033 50. VU21BTEN0100033 Lv 1 1 pt. 11,359

Comments