Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,513
  2. Avatar for Go Science 2. Go Science 71 pts. 12,313
  3. Avatar for Contenders 3. Contenders 49 pts. 12,073
  4. Avatar for Australia 4. Australia 33 pts. 12,068
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 12,014
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 11,939
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,894
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 11,692
  9. Avatar for Russian team 9. Russian team 3 pts. 11,680
  10. Avatar for VeFold 10. VeFold 2 pts. 11,662
  1. Avatar for wosser1 61. wosser1 Lv 1 1 pt. 10,944
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 10,934
  3. Avatar for TheFireOcean 63. TheFireOcean Lv 1 1 pt. 10,926
  4. Avatar for futsall 64. futsall Lv 1 1 pt. 10,900
  5. Avatar for toocajun 65. toocajun Lv 1 1 pt. 10,888
  6. Avatar for sanni4jc 66. sanni4jc Lv 1 1 pt. 10,849
  7. Avatar for Savas 67. Savas Lv 1 1 pt. 10,804
  8. Avatar for IKIRU 68. IKIRU Lv 1 1 pt. 10,663
  9. Avatar for sciencerit 69. sciencerit Lv 1 1 pt. 10,631
  10. Avatar for froschi2 70. froschi2 Lv 1 1 pt. 10,629

Comments