Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 41,033
  2. Avatar for Team China 12. Team China 1 pt. 39,409
  3. Avatar for bio 13. bio 1 pt. 25,562
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 47 pts. 41,982
  2. Avatar for Serca 12. Serca Lv 1 43 pts. 41,964
  3. Avatar for blazegeek 13. blazegeek Lv 1 40 pts. 41,956
  4. Avatar for MicElephant 14. MicElephant Lv 1 36 pts. 41,922
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 33 pts. 41,920
  6. Avatar for guineapig 16. guineapig Lv 1 30 pts. 41,906
  7. Avatar for spvincent 17. spvincent Lv 1 28 pts. 41,905
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 25 pts. 41,864
  9. Avatar for drjr 19. drjr Lv 1 23 pts. 41,830
  10. Avatar for akaaka 20. akaaka Lv 1 21 pts. 41,827

Comments