Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 47 pts. 41,982
  2. Avatar for Serca 12. Serca Lv 1 43 pts. 41,964
  3. Avatar for blazegeek 13. blazegeek Lv 1 40 pts. 41,956
  4. Avatar for MicElephant 14. MicElephant Lv 1 36 pts. 41,922
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 33 pts. 41,920
  6. Avatar for guineapig 16. guineapig Lv 1 30 pts. 41,906
  7. Avatar for spvincent 17. spvincent Lv 1 28 pts. 41,905
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 25 pts. 41,864
  9. Avatar for drjr 19. drjr Lv 1 23 pts. 41,830
  10. Avatar for akaaka 20. akaaka Lv 1 21 pts. 41,827

Comments