Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 41,033
  2. Avatar for Team China 12. Team China 1 pt. 39,409
  3. Avatar for bio 13. bio 1 pt. 25,562
  1. Avatar for jamiexq 31. jamiexq Lv 1 7 pts. 41,430
  2. Avatar for latin krepin 32. latin krepin Lv 1 6 pts. 41,300
  3. Avatar for kitsoune 33. kitsoune Lv 1 5 pts. 41,292
  4. Avatar for roarshock 34. roarshock Lv 1 5 pts. 41,280
  5. Avatar for maithra 35. maithra Lv 1 4 pts. 41,261
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 4 pts. 41,233
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 3 pts. 41,190
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 41,101
  9. Avatar for ProfVince 39. ProfVince Lv 1 2 pts. 41,075
  10. Avatar for Alistair69 40. Alistair69 Lv 1 2 pts. 41,051

Comments