Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233
  1. Avatar for jamiexq 31. jamiexq Lv 1 7 pts. 41,430
  2. Avatar for latin krepin 32. latin krepin Lv 1 6 pts. 41,300
  3. Avatar for kitsoune 33. kitsoune Lv 1 5 pts. 41,292
  4. Avatar for roarshock 34. roarshock Lv 1 5 pts. 41,280
  5. Avatar for maithra 35. maithra Lv 1 4 pts. 41,261
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 4 pts. 41,233
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 3 pts. 41,190
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 41,101
  9. Avatar for ProfVince 39. ProfVince Lv 1 2 pts. 41,075
  10. Avatar for Alistair69 40. Alistair69 Lv 1 2 pts. 41,051

Comments