Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,918
  2. Avatar for Contenders 2. Contenders 68 pts. 17,895
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 17,888
  4. Avatar for Go Science 4. Go Science 27 pts. 17,886
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 17,874
  6. Avatar for Australia 6. Australia 9 pts. 17,829
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 17,794
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 17,682
  9. Avatar for Kotocycle 9. Kotocycle 1 pt. 17,670
  10. Avatar for VeFold 10. VeFold 1 pt. 17,648
  1. Avatar for fpc 11. fpc Lv 1 39 pts. 17,874
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 35 pts. 17,869
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 32 pts. 17,865
  4. Avatar for blazegeek 14. blazegeek Lv 1 29 pts. 17,861
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 26 pts. 17,844
  6. Avatar for NPrincipi 16. NPrincipi Lv 1 23 pts. 17,833
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 20 pts. 17,829
  8. Avatar for akaaka 18. akaaka Lv 1 18 pts. 17,827
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 16 pts. 17,824
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 14 pts. 17,794

Comments