Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,918
  2. Avatar for Contenders 2. Contenders 68 pts. 17,895
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 17,888
  4. Avatar for Go Science 4. Go Science 27 pts. 17,886
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 17,874
  6. Avatar for Australia 6. Australia 9 pts. 17,829
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 17,794
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 17,682
  9. Avatar for Kotocycle 9. Kotocycle 1 pt. 17,670
  10. Avatar for VeFold 10. VeFold 1 pt. 17,648
  1. Avatar for Arne Heessels 41. Arne Heessels Lv 1 1 pt. 17,318
  2. Avatar for Mohoernchen 42. Mohoernchen Lv 1 1 pt. 17,313
  3. Avatar for Rav3n_pl 43. Rav3n_pl Lv 1 1 pt. 17,237
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 17,165
  5. Avatar for rinze 45. rinze Lv 1 1 pt. 17,107
  6. Avatar for Swapper242 46. Swapper242 Lv 1 1 pt. 17,059
  7. Avatar for DScott 47. DScott Lv 1 1 pt. 17,044
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 17,039
  9. Avatar for evifnoskcaj 49. evifnoskcaj Lv 1 1 pt. 17,034
  10. Avatar for Sammy3c2b1a0 50. Sammy3c2b1a0 Lv 1 1 pt. 17,024

Comments