Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,918
  2. Avatar for Contenders 2. Contenders 68 pts. 17,895
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 17,888
  4. Avatar for Go Science 4. Go Science 27 pts. 17,886
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 17,874
  6. Avatar for Australia 6. Australia 9 pts. 17,829
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 17,794
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 17,682
  9. Avatar for Kotocycle 9. Kotocycle 1 pt. 17,670
  10. Avatar for VeFold 10. VeFold 1 pt. 17,648
  1. Avatar for SemperRabbit 21. SemperRabbit Lv 1 13 pts. 17,768
  2. Avatar for drumpeter18yrs9yrs 22. drumpeter18yrs9yrs Lv 1 11 pts. 17,760
  3. Avatar for rosie4loop 23. rosie4loop Lv 1 10 pts. 17,750
  4. Avatar for alcor29 24. alcor29 Lv 1 9 pts. 17,738
  5. Avatar for maithra 25. maithra Lv 1 7 pts. 17,701
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 6 pts. 17,682
  7. Avatar for Ikuso 27. Ikuso Lv 1 6 pts. 17,670
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 5 pts. 17,668
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 4 pts. 17,648
  10. Avatar for ShadowTactics 30. ShadowTactics Lv 1 4 pts. 17,586

Comments