Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,498
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,862
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 4,514
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 19 pts. 12,158
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 17 pts. 12,148
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 16 pts. 12,147
  4. Avatar for alcor29 24. alcor29 Lv 1 14 pts. 12,112
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 13 pts. 12,082
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 11 pts. 12,072
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 10 pts. 12,058
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 9 pts. 12,008
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 8 pts. 11,983
  10. Avatar for Larini 30. Larini Lv 1 7 pts. 11,942

Comments