Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 22 pts. 10,283
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 20 pts. 10,241
  3. Avatar for zanbato 23. zanbato Lv 1 18 pts. 10,233
  4. Avatar for alcor29 24. alcor29 Lv 1 17 pts. 10,230
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 15 pts. 10,225
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 14 pts. 10,189
  7. Avatar for Alistair69 27. Alistair69 Lv 1 12 pts. 10,173
  8. Avatar for Dr.Sillem 28. Dr.Sillem Lv 1 11 pts. 10,170
  9. Avatar for maithra 29. maithra Lv 1 10 pts. 10,129
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 9 pts. 10,114

Comments