Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 22 pts. 10,283
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 20 pts. 10,241
  3. Avatar for zanbato 23. zanbato Lv 1 18 pts. 10,233
  4. Avatar for alcor29 24. alcor29 Lv 1 17 pts. 10,230
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 15 pts. 10,225
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 14 pts. 10,189
  7. Avatar for Alistair69 27. Alistair69 Lv 1 12 pts. 10,173
  8. Avatar for Dr.Sillem 28. Dr.Sillem Lv 1 11 pts. 10,170
  9. Avatar for maithra 29. maithra Lv 1 10 pts. 10,129
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 9 pts. 10,114

Comments