Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for mnucer 31. mnucer Lv 1 8 pts. 10,100
  2. Avatar for hada 32. hada Lv 1 7 pts. 10,099
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 7 pts. 10,091
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 6 pts. 10,052
  5. Avatar for ppp6 35. ppp6 Lv 1 5 pts. 10,052
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 5 pts. 10,045
  7. Avatar for manu8170 37. manu8170 Lv 1 4 pts. 10,005
  8. Avatar for JuliaBCollet 38. JuliaBCollet Lv 1 4 pts. 9,998
  9. Avatar for heather-1 39. heather-1 Lv 1 3 pts. 9,976
  10. Avatar for nicobul 40. nicobul Lv 1 3 pts. 9,910

Comments