Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233
  1. Avatar for mnucer 31. mnucer Lv 1 8 pts. 10,100
  2. Avatar for hada 32. hada Lv 1 7 pts. 10,099
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 7 pts. 10,091
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 6 pts. 10,052
  5. Avatar for ppp6 35. ppp6 Lv 1 5 pts. 10,052
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 5 pts. 10,045
  7. Avatar for manu8170 37. manu8170 Lv 1 4 pts. 10,005
  8. Avatar for JuliaBCollet 38. JuliaBCollet Lv 1 4 pts. 9,998
  9. Avatar for heather-1 39. heather-1 Lv 1 3 pts. 9,976
  10. Avatar for nicobul 40. nicobul Lv 1 3 pts. 9,910

Comments