Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for nancy_annys 41. nancy_annys Lv 1 3 pts. 9,904
  2. Avatar for Steven Pletsch 42. Steven Pletsch Lv 1 2 pts. 9,873
  3. Avatar for akaaka 43. akaaka Lv 1 2 pts. 9,854
  4. Avatar for Larini 44. Larini Lv 1 2 pts. 9,827
  5. Avatar for Trajan464 45. Trajan464 Lv 1 2 pts. 9,801
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 2 pts. 9,785
  7. Avatar for pfirth 47. pfirth Lv 1 1 pt. 9,775
  8. Avatar for KRUK94 48. KRUK94 Lv 1 1 pt. 9,774
  9. Avatar for DScott 49. DScott Lv 1 1 pt. 9,770
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 9,759

Comments