Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233
  1. Avatar for nancy_annys 41. nancy_annys Lv 1 3 pts. 9,904
  2. Avatar for Steven Pletsch 42. Steven Pletsch Lv 1 2 pts. 9,873
  3. Avatar for akaaka 43. akaaka Lv 1 2 pts. 9,854
  4. Avatar for Larini 44. Larini Lv 1 2 pts. 9,827
  5. Avatar for Trajan464 45. Trajan464 Lv 1 2 pts. 9,801
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 2 pts. 9,785
  7. Avatar for pfirth 47. pfirth Lv 1 1 pt. 9,775
  8. Avatar for KRUK94 48. KRUK94 Lv 1 1 pt. 9,774
  9. Avatar for DScott 49. DScott Lv 1 1 pt. 9,770
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 9,759

Comments