Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for Merf 51. Merf Lv 1 1 pt. 9,727
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 9,716
  3. Avatar for alyssa_d_V2.0 53. alyssa_d_V2.0 Lv 1 1 pt. 9,653
  4. Avatar for jawz101 54. jawz101 Lv 1 1 pt. 9,628
  5. Avatar for wosser1 55. wosser1 Lv 1 1 pt. 9,591
  6. Avatar for Deleted player 56. Deleted player 1 pt. 9,496
  7. Avatar for mengzach 57. mengzach Lv 1 1 pt. 9,485
  8. Avatar for wudooAI 58. wudooAI Lv 1 1 pt. 9,481
  9. Avatar for WuWTq 59. WuWTq Lv 1 1 pt. 9,449
  10. Avatar for frostschutz 60. frostschutz Lv 1 1 pt. 9,440

Comments